If you have been reading about AEDG and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-04-20. Numbers and descriptions here follow the published literature rather than marketing material.
Because epitalon has no pharmacopoeial monograph, quality assessment depends on supplier documentation and independent testing. Certificates of analysis typically report a purity figure from a single chromatographic run, a measured mass and sometimes an appearance description, but methods and acceptance criteria are not harmonised across vendors. Third-party laboratories can repeat identity and purity measurements, and mismatches between labelled and measured peptide content have been described for research peptides generally. What constitutes adequate identity confirmation for a molecule of this size stays an open question, since mass agreement alone does not separate closely related sequences.
Identity testing for epitalon relies on reversed-phase high-performance liquid chromatography for purity and mass spectrometry for mass confirmation. Because the sequence contains no tryptophan or tyrosine, ultraviolet detection at 280 nanometres is insensitive, so chromatographic methods usually monitor absorbance near 214 nanometres, where the peptide backbone absorbs. Electrospray ionisation or matrix-assisted laser desorption/ionisation then checks the intact mass against the expected value near 390 daltons. Peptide mapping or amino acid analysis after acid hydrolysis can supplement these measurements, although such confirmatory work is seldom reported on commercial certificates of analysis.
Stability of the tetrapeptide follows ordinary peptide chemistry rather than any unusual structural feature. The aspartate-glycine pair is prone to aspartimide formation under mildly basic or neutral conditions, and deamidation can follow, altering both mass and chromatographic retention. Dry lyophilised powder kept at or below minus twenty degrees Celsius is the usual handling recommendation, with repeated freeze-thaw cycles avoided. Once dissolved in neutral aqueous buffer, degradation proceeds over days to weeks depending on pH and temperature, while acidic conditions generally slow the aspartimide route. A formal stability-indicating study has not been published in the indexed literature.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
| Property | Value | Notes |
|---|---|---|
| Analytical method | Reversed-phase HPLC | Purity determination, typically 214 nm |
| Mass confirmation | ESI or MALDI mass spectrometry | Compared with mass near 390 Da |
| Common synonyms | Epitalon, epithalon, AEDG | Naming differs between suppliers |
| Storage temperature | −20 °C or lower | Lyophilised powder, kept desiccated |
| Solution stability | Limited in neutral aqueous buffer | Aspartimide and hydrolysis pathways |
Regulatory treatment differs by country. No formulation of epitalon holds a marketing authorisation as a medicine in the United States or the European Union, where material sold for laboratory use is handled as a research chemical and is not intended for human consumption. In Russia, several short peptide preparations from the same institute's peptide series are registered medicinal products, and epitalon appears in that national context. Elsewhere it is frequently offered as a cosmetic ingredient, a category with lighter requirements. Advertising claims about longevity or disease prevention are restricted in most jurisdictions, which limits how sellers describe the compound.
Freeze-dried epitalon is normally kept at minus twenty degrees Celsius in a sealed, desiccated container, protected from light. Short excursions at ambient temperature during shipping are generally tolerated, but repeated warming and cooling cycles encourage moisture uptake, which shortens shelf life. Once dissolved, the peptide is far less stable than the solid: aqueous solutions are subject to hydrolysis and to deamidation at the aspartate and glutamate residues. Working solutions are therefore held refrigerated and used within days, and repeated freezing and thawing of the same vial is best avoided.
Identity and purity are checked by reversed-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, where the peptide bond absorbs. Mass spectrometry confirms the expected mass and reveals whether truncation products or adducts are present. Acid hydrolysis followed by amino acid analysis gives the residue ratio, which should approximate one alanine, one glutamate, one aspartate and one glycine. Counter-ions such as acetate or trifluoroacetate remain in the dried product and lower net peptide content, so a stated purity figure on a label does not by itself describe how much peptide a vial holds.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
== Further reading == Louis Beres, Apocalypse: Nuclear Catastrophe in World Politics. The risks and consequences of nuclear war and nuclear terrorism. University of Chicago Press, Chicago, 1980. ISBN 9780226043609 Laura Grego and David Wright, "Broken Shield: Missiles designed to destroy incoming nuclear warheads fail frequently in tests and could increase global risk of mass destruction", Scientific American, vol. 320, no. no. 6 (June 2019), pp. 62–67. "Nuclear-armed missiles are a political problem that technology cannot solve.... Current U.S. missile defense plans are being driven largely by technology, politics and fear. Missile defenses will not allow us to escape our vulnerability to nuclear weapons. Instead large-scale developments will create barriers to taking real steps toward reducing nuclear risks—by blocking further cuts in nuclear arsenals and potentially spurring new deployments." (p. 67.) Jessica T. Mathews, "The New Nuclear Threat", The New York Review of Books, vol. LXVII, no. 13 (20 August 2020), pp. 19–21. "[P]owerful reasons to doubt that there could be a limited nuclear war [include] those that emerge from any study of history, a knowledge of how humans act under pressure, or experience of government." (p. 20.) National Academies of Sciences, Engineering, and Medicine. 2025. Potential Environmental Effects of Nuclear War. The National Academies Press. "Possibility of Nuclear War in Asia: An Indian Perspective", a project of United Service Institution of India, USI, Discusses the possibility of a nuclear war in Asia from the Indian point of view.
Cereblon is a protein that in humans is encoded by the CRBN gene. The gene that encodes the cereblon protein is found on the human chromosome 3, on the short arm at position p26.3 from base pair 3,190,676 to base pair 3,221,394. CRBN orthologs are highly conserved from plants to humans.
== Synthesis == Numerous methods are available for the preparation of nitriles. These include Kolbe nitrile synthesis, dehydration of carboxylic acid amides and oximes, and oxidation of primary amines. Industrially, the main methods for producing nitriles are ammoxidation and hydrocyanation. Both routes are green in the sense that they do not generate stoichiometric amounts of salts.
=== Main === Jean Smart as Deborah Vance, a revered Las Vegas stand-up comedian decades into her career Hannah Einbinder as Ava Daniels, a 25-year-old down-on-her-luck comedy writer forced to leave Los Angeles and work with Deborah Vance Carl Clemons-Hopkins as Marcus, the loyal workaholic COO of Deborah's company
== Professional activities == After earning a Ph.D. degree in biochemistry, a medical degree, and completing a research postdoctoral fellowship at the University of Wisconsin–Madison, Holick completed a residency in medicine at the Massachusetts General Hospital in Boston. He has been practicing adult and pediatric endocrinology since 1978 and is professor of medicine, physiology and biophysics and director of the Bone Health Care Clinic and the Heliotherapy, Light, and Skin Research Center at Boston University Medical Center. It provides extensive evaluation and treatment programs for children and adults with various metabolic bone diseases including osteoporosis, osteomalacia, stress fractures in young athletic women and men, and minimum trauma and nontraumatic fractures in infants, children and adults with hypermobility syndromes, osteogenesis imperfecta, and Ehlers–Danlos syndrome. He has been director of the General Clinical Research Unit at Boston University for several years. Holick serves as chair of NASA's "Human Health Countermeasures Element" Standing Review Panel, chair of the Endocrine Practice Guidelines Committee for Vitamin D, and editor-in-chief of the medical journal Clinical Laboratory.
Sources: en.wikipedia.org
== Activating reagent == NHS is commonly found in organic chemistry or biochemistry where it is used as an activating reagent for carboxylic acids. Activated acids (carboxylates) can react with amines to form amides for example, whereas a normal carboxylic acid would just form a salt with an amine.
=== Antidepressants === Medications that are indicated for both anxiety disorders and depression. Selective serotonin reuptake inhibitors (SSRIs) and serotonin–norepinephrine reuptake inhibitors (SNRIs) are new generations of antidepressants. They have a much lower adverse effect profile than older antidepressants like monoamine oxidase inhibitors (MAOIs) and tricyclic antidepressants (TCAs). Therefore, SSRIs and SNRIs are now the first-line agent in treating long term anxiety disorders, given their applications and significance in all six types of disorders.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
===== Teleost fish ===== Like non-placental vertebrates, teleost fish also possess 5-HT cells in other sections of the brain, including the basal forebrain. Danio rerio (zebra fish) are a species of teleost fish often used for studying serotonin within the brain. Despite much being unknown about serotonergic systems in vertebrates, the importance in moderating stress and social interaction is known. It is hypothesized that AVT and CRF cooperate with serotonin in the hypothalamic-pituitary-interrenal axis. These neuropeptides influence the plasticity of the teleost, affecting its ability to change and respond to its environment. Subordinate fish in social settings show a drastic increase in 5-HT concentrations. High levels of 5-HT long term influence the inhibition of aggression in subordinate fish.
With their large fore-flippers, eared seals are usually able to prevent the first bite from being secure, but are still weakened and vulnerable to being recaptured. Prey is released after it dies of blood loss, and the shark feeds on the carcass after it floats to the surface. In 1984, Timothy Tricas and John McCosker suggested that white sharks bite seals, release them, and then wait for them to bleed to death before eating based on observations at Dangerous Reef, South Australia. Others have found no evidence for this hypothesis, but the strategy is possibly employed on bull elephant seals. Off South Africa, ambushes on Cape fur seals usually involve the shark leaping or breaching out of the water. To breach, a shark starts at around 20 m (66 ft) below the surface and ascends quickly towards its target while tilting its body vertically. Sharks may breach partially or entirely out of the water at different angles, clearing up to around 3 m (10 ft) when airborne. Missed seals may be chased after; such pursuits involve the prey using its speed and agility to escape as the shark employs various maneuvers to catch them. The longer the chase, the less likely the shark is to succeed. Sharks commonly consume fur seals quickly after they are killed. White sharks in Cape Cod hunt seals in shallow water, relying on the murkiness of the water for concealment and striking them from the sides.
Sources: en.wikipedia.org
=== God === Religions such as Judaism and Christianity hold that God created the entire universe and everything in it. He has spiritual attributes found in angels and humans. God has unique attributes of omnipotence, omnipresence, and omniscience. He is the model of perfection in all of creation.
Murine respirovirus, now Respirovirus muris, formerly Sendai virus (SeV) and previously also known as murine parainfluenza virus type 1 or hemagglutinating virus of Japan (HVJ), is an enveloped, 150–200 nm diameter, negative sense, single-stranded RNA virus of the family Paramyxoviridae. It typically infects rodents and it is not pathogenic for humans or domestic animals. Respirovirus muris is a member of the genus Respirovirus. The virus was isolated in the city of Sendai in Japan in the early 1950s. Since then, it has been actively used in research as a model pathogen. The virus is infectious for many cancer cell lines (see below), and has oncolytic properties demonstrated in animal models and in naturally occurring cancers in animals. Its ability to fuse eukaryotic cells and to form syncytium was used to produce hybridoma cells capable of manufacturing monoclonal antibodies in large quantities. Recent applications of SeV-based vectors include the reprogramming of somatic cells into induced pluripotent stem cells and vaccine creation. For vaccination purpose the Sendai virus-based constructs could be delivered in a form of nasal drops, which may be beneficial in inducing a mucosal immune response. SeV has several features that are important in a vector for a successful vaccine: the virus does not integrate into the host genome, it does not undergo genetic recombination, it replicates only in the cytoplasm without DNA intermediates or a nuclear phase and it does not cause any disease in humans or domestic animals.
These failures suggested that either these are the wrong molecular targets to induce neovascularization, that they can only be effectively used if formulated and administered correctly, or that their presentation in the context of the overall cellular microenvironment may play a vital role in their utility. It may be necessary to present these proteins in a way that mimics natural signaling events, including the concentration, spatial and temporal profiles, and their simultaneous or sequential presentation with other appropriate factors.
==== 2012 effective ban by China of Korean kimchi imports ==== Since 2012, the Chinese government has effectively banned the import of Korean kimchi through government regulations. Ignoring the standards of kimchi outlined by the Codex Alimentarius, China defined kimchi as a derivative of one of its own cuisines, called pao cai. However, due to significantly different preparation techniques from pao cai, kimchi has significantly more lactic acid bacteria through its fermentation process, which exceeds China's regulations. Since 2012, commercial exports of Korean kimchi to China has reached zero; the only minor amounts of exports accounting for Korean kimchi are exhibition events held in China.
The East Central Conference was founded in 1970 by eight medium-sized high schools in east central Wisconsin. Six of the eight schools were displaced by the dissolution of their previous conferences: three from the Little Nine Conference (Hortonville, Omro and Winneconne), two from the Little Ten Conference (Berlin and Ripon) and New London of the Mid-Eastern Conference. Former Central Wisconsin Conference members Waupaca and Weyauwega rounded out the original eight. In 1973, Weyauwega left the East Central Conference to rejoin the CWC, and Little Chute joined from the CWC as their replacement the following year. In 1979, New London exited for membership in the Bay Conference with Wautoma moving over from the CWC to maintain an eight-member conference. Aside from Waupun replacing Wautoma as a football-only member in 1995, the all-sport membership roster would remain intact for the next twenty years. In 1999, Hortonville, Little Chute and Waupaca became charter members of the Valley 8 Conference. Laconia and Markesan joined the ECC from the neighboring Flyway Conference to take the vacated members' place. For football, the two new members stayed in the Flyway Conference, with Mayville and St. Mary's Springs in Fond du Lac joining as football-only members. Two years later, the seven schools of the East Central Conference merged with the nine members of the Flyway Conference to form the East Central Flyway Conference.
Sources: en.wikipedia.org
The molecule lacks aromatic residues, so it absorbs weakly near 280 nanometres, the wavelength applied to many other peptides. The peptide bond absorbs strongly below 220 nanometres, making 214 nanometres a practical compromise. Gradient methods must therefore use mobile phases with low ultraviolet absorbance to keep the baseline clean.
Neutral and slightly basic aqueous conditions promote aspartimide formation at the aspartate-glycine step, often followed by deamidation. Elevated temperature and repeated freeze-thaw cycles accelerate the loss. Acidic solutions and dry lyophilised powder are comparatively stable over short periods.
No monograph exists in the United States Pharmacopeia or the European Pharmacopoeia, and no widely distributed certified reference standard is available. Purity and identity therefore rest on supplier methods that are not harmonised. This absence is the main reason reported purities are difficult to compare between sources.
It is a synthetic tetrapeptide. Its sequence was derived from research on peptide fractions of bovine pineal extract, and the intact AEDG sequence has not been demonstrated as an abundant free peptide in human tissue.