Lyophilized powder is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-05-14. Where a claim depends on a specific study, the study is described rather than over-claimed.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. It was designed at the St. Petersburg Institute of Bioregulation and Gerontology as a short, chemically defined analogue of epithalamin, a fraction obtained from bovine pineal tissue. Small peptide bioregulators of this type formed a long-running line of work there from the 1980s onward. Because the molecule is produced by solid-phase synthesis rather than extraction, its composition is exact and its purity can be measured directly.
The most frequently cited proposed action is induction of telomerase, the enzyme that adds repeat sequences to chromosome ends. Cell-culture work from the originating group reported higher telomerase reverse transcriptase expression and measurable telomere elongation in human somatic cells after exposure. How a four-residue peptide would reach nuclear gene regulation is not established, and no cell-surface receptor or uptake route has been identified. Additional reports describe changes in melatonin secretion, antioxidant enzyme activity and lipid peroxidation in aged animals, but these findings remain mechanistically unconnected to the telomerase observation.
Published evidence comes mainly from Russian-language journals and from a single research group, with small sample sizes and limited independent replication. A few laboratories outside that group have examined related peptides and reported weaker or absent telomerase effects, so the central claim is best described as contested rather than settled. Rodent studies report modest changes in some ageing markers and in survival, but designs vary and control conditions are often sparse. No large randomised trial in humans has been published, and long-term safety data in healthy populations are correspondingly thin.
Laboratory-grade epitalon is typically supplied as a lyophilized powder. Purity is commonly assessed with reverse-phase high-performance liquid chromatography, often paired with mass spectrometry to confirm molecular identity. Amino acid analysis and peptide mapping can provide additional confirmation of sequence. Certificates of analysis for research materials frequently report purity above 95 percent, although the methods behind such figures vary between suppliers. The absence of a pharmacopeial monograph means that no single standardized assay defines the compound, so reported results depend on the analytical protocol chosen.
Storage recommendations center on limiting moisture, heat, and light. The dry powder is generally kept at minus 20 degrees Celsius, and some suppliers recommend minus 80 degrees for long-term archival. Once dissolved, solutions are usually aliquoted and frozen to avoid repeated freeze-thaw cycles, which can promote aggregation or degradation. Aqueous stability depends on pH and concentration, and buffered saline is often preferred over plain water for biological work. Stability data specific to epitalon remain limited, so general peptide-handling practices are applied by analogy rather than from product-specific validation.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and its calculated monoisotopic mass is approximately 390.35 daltons. The compound does not occur naturally as a free peptide; it is produced by solid-phase peptide synthesis. Because it contains two acidic residues and no basic residues, the neutral form carries a net negative charge at physiological pH. This charge profile influences how the peptide behaves in solution and during chromatographic analysis.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C14H22N4O9 | Calculated from the four residues with three water losses |
| Molecular mass | About 390.35 g/mol | Monoisotopic mass near 390.14, used for mass-spectrometric identification |
| Peptide sequence | Ala-Glu-Asp-Gly | Single-letter form AEDG; no disulfide bonds or modified residues |
| Appearance | White to off-white solid | Supplied as a dried powder |
| Isoelectric point | Around 4 | Estimated from aspartate and glutamate side-chain pKa values |
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
Epitalon is a synthetic tetrapeptide with the residue sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. Its monoisotopic mass is approximately 390.35 daltons, and it is usually supplied as a lyophilised trifluoroacetate or acetate salt. The compound was derived from a pineal gland extract called epithalamin, a heterogeneous preparation investigated in the former Soviet Union. Researchers associated with the Saint Petersburg Institute of Bioregulation and Gerontology described the tetrapeptide as a constituent fragment of that extract. Commercial material is offered as a laboratory reagent rather than as a finished pharmaceutical product.
Literature searches for this compound must account for several spelling variants. Indexing databases contain epitalon, epithalon, epithalone, and AEDG, and relevant records are scattered across Russian-language and English-language journals that do not consistently cross-cite. Early publications describe the parent extract as a mixture of many peptides, whereas later work addresses the single synthetic tetrapeptide. That shift in nomenclature complicates comparison between studies, because extract data and tetrapeptide data are sometimes cited interchangeably. A search strategy omitting the alternate spellings will return an incomplete set of references.
== Reception == Cry of Fear has received generally positive reviews, with reviewers praising its overall atmosphere and unique setting. Reviewers praised the game's story, atmosphere, tension, enemy designs, and inventory management, while some criticism was levied at the game's platforming segments and occasional crashes and bugs. Eric Sapp of IGN called the game "terrifying" and praised the addition of an inventory system with limited space similar to Resident Evil series for the decision making aspect. Antony Wright of SUPERJUMP named Cry of Fear "arguably the most disturbing and depraved horror title that I've ever played through" while also commending the game for sympathetically handling mature topics. Dennis Moiseyev and Destry Stutesman of The Gamer positively compared Cry of Fear to the Silent Hill series through its use of nightmare sequences, while employing a first-person perspective. Luke Plunkett of Kotaku opined that while the old engine made the game "a little janky" at times, the graphics and music in Cry of Fear were "genuinely tense". A review on Jeuxvideo.com praised the innovations to the GoldSrc engine, calling the improved the graphics and lighting in Cry of Fear unrecognized to Half-Life. Although acknowledging the technical limitations of an outdated engine, the music and "gloomy atmosphere" were also applauded by Jeuxvideo.com, stating the game proves "that a graphics engine, no matter how old it may be, can do some very beautiful things if it is used well".
Hormones in cattle had been studied in North America for 50 years prior to the ban, accompanied by long-term use in over 20 countries. Canada and the United States asserted that these practices provided empirical evidence of long-term safety. The EU had already established other measures that restricted the import of North American beef. The primary North American product affected by the new ban was edible offal. A series of "hormone scandals" emerged in Italy in the late 1970s and early 1980s. The first, in 1977, was the discovery of premature puberty in northern Italian schoolchildren. Investigators cast suspicion on school lunches that used illegal hormone-treated meat. No concrete evidence was found–no samples of the suspect meals were available for analysis. In 1980 diethylstilbestrol (DES), another illegal synthetic hormone, was discovered in veal-based baby foods. Little or no scientific evidence supported these restrictions. However, consumer groups successfully influenced the European Parliament to enact regulations in the 1980s, and influenced public perceptions. In the US at the time, consumer organizations evinced little interest prior to the 1980s, and regulations were driven by a coalition of export-oriented industry and farming interests, opposed only by organic farming groups. Until 1980, the use of growth hormones was completely prohibited in Italy, Denmark, the Netherlands, and Greece. Germany, the EU's largest beef producer at the time, prohibited only exogenous growth hormones.
For Psylocke’s new look, which I collaborated on with Chris Claremont, she appears on the cover in armor. That was my first take on the character, which I had to get done for the cover before I had finished the interior look, and I don’t think Chris had signed off on yet. He didn’t like that direction as much -- he wanted something slinkier, more like Elektra -- that you eventually see inside that issue. But that discussion led us to modify the story a little. When you first see her, she’s in that armor, and through a psychic conflict, you see it smashed off of her body to unveil the new costume that Chris wanted. A 1993 story by Fabian Nicieza would retroactively establish that Braddock's changed appearance was the product of a body swap between Braddock and the assassin Kwannon. In the Claremont-written X-Treme X-Men #2 (2001), the character dies, her comic book death lasting until 2005's Uncanny X-Men #455. During the 2018 "Hunt for Wolverine" storyline, the psychic vampire Sapphire Styx absorbs Braddock's soul, leaving her body dead. After destroying Styx from the inside with assistance from a fragment of Wolverine's soul, Braddock reconstitutes her original body with Styx's remaining soul power. During the Dawn of X, Braddock subsequently took up her brother Brian's former title of Captain Britain, forming a new iteration of Excalibur with Apocalypse, Gambit, Rogue, Jubilee, and Rictor, to protect the Kingdom of Avalon.
=== Magnetic === In 2015 researchers announced a graphene-based magnetic sensor 100 times more sensitive than an equivalent device based on silicon (7,000 volts per amp-tesla). The sensor substrate was hexagonal boron nitride. The sensors were based on the Hall effect, in which a magnetic field induces a Lorentz force on moving electric charge carriers, leading to deflection and a measurable Hall voltage. In the worst case graphene roughly matched a best case silicon design. In the best case graphene required lower source current and power requirements.
Sources: en.wikipedia.org
The alkalides are an exception: they are unstable compounds which contain alkali metals in a −1 oxidation state, which is very unusual as before the discovery of the alkalides, the alkali metals were not expected to be able to form anions and were thought to be able to appear in salts only as cations. The alkalide anions have filled s-subshells, which gives them enough stability to exist. All the stable alkali metals except lithium are known to be able to form alkalides, and the alkalides have much theoretical interest due to their unusual stoichiometry and low ionisation potentials. Alkalides are chemically similar to the electrides, which are salts with trapped electrons acting as anions. A particularly striking example of an alkalide is "inverse sodium hydride", H+Na− (both ions being complexed), as opposed to the usual sodium hydride, Na+H−: it is unstable in isolation, due to its high energy resulting from the displacement of two electrons from hydrogen to sodium, although several derivatives are predicted to be metastable or stable. In aqueous solution, the alkali metal ions form aqua ions of the formula [M(H2O)n]+, where n is the solvation number. Their coordination numbers and shapes agree well with those expected from their ionic radii. In aqueous solution the water molecules directly attached to the metal ion are said to belong to the first coordination sphere, also known as the first, or primary, solvation shell. The bond between a water molecule and the metal ion is a dative covalent bond, with the oxygen atom donating both electrons to the bond.
Absinthe was historically bottled at 45–74% ABV. Some modern Franco–Suisse absinthes are bottled at up to 83% ABV, while some modern, cold-mixed bohemian-style absinthes are bottled at up to 89.9% ABV.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== Sensory === LSD induces an animated sensory experience affecting senses, emotions, memories, time, and awareness. The effects range from subtle perceptual changes to profound cognitive shifts. Alterations in auditory and visual perception are common. Users may experience enhanced visual phenomena, such as vibrant colors, objects appearing to morph, ripple, or move, and geometric patterns on various surfaces. Changes in the perception of food's texture and taste are also noted, sometimes leading to aversion towards certain foods. There are reports of inanimate objects appearing animated, with static objects seeming to move in additional spatial dimensions. The auditory effects of LSD may include echo-like distortions of sounds, and an intensified experience of music. Basic visual effects often resemble phosphenes and can be influenced by concentration, thoughts, emotions, or music. Higher doses can lead to more intense sensory perception alterations, including synesthesia, perception of additional dimensions, and temporary dissociation.
Antibody Solutions is a privately held American contract research organization headquartered in Santa Clara, California. It provides research and discovery services and fit-for-purpose antibodies to biopharmaceutical and diagnostic companies and academic researchers worldwide. The company’s services include monoclonal and polyclonal antibody and antigen development, molecular modeling, antibody sequencing and engineering, bioreactor technology, pharmacokinetic studies, antibody epitope binning, peptide synthesis, immunoassay development, ligand-binding assay analysis, and support for CAR-T research.
Sources: en.wikipedia.org
No. Epithalamin is a peptide-containing extract of bovine pineal glands, while epitalon is a single synthetic tetrapeptide. The extract contains many peptides and other tissue components, so its composition varies between batches in ways that a synthesised sequence does not.
It is not recognised as an endogenous peptide hormone. The four-residue sequence can appear inside larger proteins and in digestive fragments of dietary protein, but no dedicated pathway producing it as a signalling molecule has been identified.
Several cell-culture reports describe increased telomerase activity after treatment, measured by enzyme assays or by transcript levels. Results differ between cell types and laboratories, and measured telomere lengthening has been reported in some studies but not in others, which leaves the physiological relevance open.
Epitalon is a synthetic tetrapeptide built from four amino acids: alanine, glutamate, aspartate, and glycine. It is not extracted from a natural source but made in the laboratory by chemical synthesis. Its short length makes it relatively straightforward to produce at high purity.